PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G28720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 169aa    MW: 19811.1 Da    PI: 8.2539
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G28720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.9e-1379137462
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       +r rr+++NRe+ArrsR RK++++ eL   v  L + N++L ++l++    +++++ e
  OPUNC02G28720.1  79 ERRRRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCDRVTHE 137
                      6899*******************************************999999887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-1076132No hitNo description
SMARTSM003384.6E-1476140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.57678141IPR004827Basic-leucine zipper domain
PfamPF001707.8E-1078132IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-1280129No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
CDDcd147022.94E-1585132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MYPAEIASFP YLSPASAVSF KTHYHVDTND FFLQYNSLLV PQATSYQHVA HLPHETNLPV  60
GNKSNSDESD DYQRSLAEER RRRRMISNRE SARRSRMRKQ KQLSELWAQV VHLRSTNRQL  120
LDQLNHVIRD CDRVTHENCQ LRDEQAKLQK QLEKTPVENT ESTFMGPDN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
179100RRRRRMISNRESARRSRMRKQK
29299RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052840.0AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624540.11e-124PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0E0K4S21e-125A0A0E0K4S2_ORYPU; Uncharacterized protein
STRINGLOC_Os02g49560.11e-123(Oryza sativa Japonica Group)
STRINGBGIOSGA008968-PA1e-123(Oryza sativa Indica Group)
STRINGORGLA02G0265300.11e-123(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.15e-14basic leucine-zipper 43